Antibodies

Jump to Filters
View as table Download
CALHM5 Rabbit Polyclonal Antibody
TA335373

USD 375.00

5 Days

Rabbit Polyclonal Anti-FAM26E Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FAM26E Antibody is: synthetic peptide directed towards the middle region of Human FAM26E. Synthetic peptide located within the following region: ELICKGKPKECWEELHKVSCGKTSMLPTVNEELKLSLQAQSQILGWCLIC