Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Antibody against Caveolin 1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DELSEKQVYDAH, from the internal region of the protein sequence according to NP_001744.2. |
USD 340.00
2 Weeks
Caveolin 1 (CAV1) (1-104) mouse monoclonal antibody, clone AT4C1, Purified
| Applications | ELISA, FC, IF, WB |
| Reactivities | Human, Rat |
USD 230.00
2 Weeks
Caveolin 1 (CAV1) (1-104) mouse monoclonal antibody, clone AT4C1, Purified
| Applications | ELISA, FC, IF, WB |
| Reactivities | Human, Rat |
Rabbit Polyclonal Anti-Caveolin-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Caveolin-1 Antibody: A synthesized peptide derived from human Caveolin-1 |
Rabbit Polyclonal Anti-Caveolin 1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Caveolin 1 Antibody: A synthesized peptide derived from human Caveolin 1 |
CAV1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CAV1 |
Rabbit Polyclonal Caveolin-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Caveolin-1 |
Rabbit Polyclonal Caveolin-1 (Tyr14) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Caveolin-1 around the phosphorylation site of Tyrosine 14 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CAV1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CAV1 antibody: synthetic peptide directed towards the N terminal of human CAV1. Synthetic peptide located within the following region: MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEID |
Caveolin 1 (CAV1) (C-term) rabbit polyclonal antibody, Purified
| Applications | IHC |
| Reactivities | Human |
| Immunogen | A synthetic peptide from C-terminal domain of human caveolin-1 |
Rabbit Polyclonal Anti-CAV1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CAV1 antibody: synthetic peptide directed towards the N terminal of human CAV1. Synthetic peptide located within the following region: SGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDL |
Rabbit Polyclonal Anti-Caveolin-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Caveolin-1 antibody was raised against a peptide corresponding to 18 amino acids near the amino terminus of human Caveolin-1. |
Rabbit Polyclonal Anti-CAV1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CAV1 |
Caveolin-1 Mouse Monoclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Phospho-Caveolin-1-Y14 Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Modifications | Phospho Y14 |
Anti-Caveolin-1 (Tyr-14), Phosphospecific Antibody
| Applications | ICC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- CAV1