Rabbit polyclonal CAV2 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CAV2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 11-44 amino acids from the N-terminal region of human CAV2. |
Rabbit Polyclonal Anti-Caveolin 2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Caveolin 2 Antibody: A synthesized peptide derived from human Caveolin 2 |
Rabbit Polyclonal Anti-Caveolin 2 (Phospho-Tyr27) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Caveolin 2 (Phospho-Tyr27) Antibody: A synthesized peptide derived from human Caveolin 2 (Phospho-Tyr27) |
| Modifications | Phospho-specific |
Rabbit polyclonal Caveolin 2 (Tyr27) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caveolin 2 around the phosphorylation site of tyrosine 27 (L-E-YP-A-D). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CAV2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CAV2 antibody: synthetic peptide directed towards the N terminal of human CAV2. Synthetic peptide located within the following region: LVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSE |
Caveolin-2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CAV2 |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
