Rabbit Polyclonal Anti-CCDC137 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCDC137 antibody is: synthetic peptide directed towards the N-terminal region of Human CCDC137. Synthetic peptide located within the following region: RRARGRQQVQPLGKQRPAPWPGLRSKEKKKVNCKPKNQDEQEIPFRLREI |
CCDC137 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
CCDC137 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 213-288 of human CCDC137 (NP_954981.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
