Antibodies

Jump to Filters
View as table Download
CCDC17 (C-term) Rabbit Polyclonal Antibody
AP50772PU-N

USD 450.00

2 Weeks

CCDC17 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 439-477 amino acids from the C-terminal region of human CCDC17
CCDC17 Rabbit Polyclonal Antibody
TA341488

USD 375.00

5 Days

Rabbit Polyclonal Anti-CCDC17 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CCDC17 antibody is: synthetic peptide directed towards the N-terminal region of Human CCDC17. Synthetic peptide located within the following region: ARIQELQAEPGNPLSSRREAELYSPVQKANPGTLAAEIRALREAYIRDGG