Germany
Japan
United Kingdom
China
Goat Anti-Ymer / CCDC50 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CFSKSESSHKGFHYK, from the internal region of the protein sequence according to NP_848018.1; NP_777568.1. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-CCDC50 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCDC50 antibody: synthetic peptide directed towards the middle region of human CCDC50. Synthetic peptide located within the following region: GMKPRVMKEAVSTPSRMAHRDQEWYDAEIARKLQEEELLATQVDMRAAQV |
Rabbit Polyclonal Anti-CCDC50 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCDC50 antibody: synthetic peptide directed towards the middle region of human CCDC50. Synthetic peptide located within the following region: KAKEREKSSLDKRKQDPEWKPKTAKAANSKSKESDEPHHSKNERPARPPP |
CCDC50 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 10-147 of human CCDC50 (NP_777568.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CCDC50