Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Cyclin A2 (CCNA2) mouse monoclonal antibody, clone CY-28, Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse |
Rabbit Polyclonal anti-Ccna2 antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Immunogen | The immunogen for anti-Ccna2 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKHSKYHSVSLLNPPET |
Rabbit Polyclonal Anti-CCNA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCNA2 antibody: synthetic peptide directed towards the C terminal of human CCNA2. Synthetic peptide located within the following region: YTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL |
Mouse monoclonal Anti-CyclinA Clone E70.1
| Reactivities | Cow |
Mouse monoclonal Anti-CyclinA Clone E72.1
| Reactivities | Cow |
Mouse monoclonal Anti-CyclinA Clone AT10.2
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti Cyclin A Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
CCNA2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of Human CCNA2 |
Cyclin A2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human Cyclin A2 (NP_001228.1). |
| Modifications | Unmodified |
Cyclin A2 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human Cyclin A2 |
| Modifications | Unmodified |
Active filters
Target Symbol
- CCNA2