Antibodies

View as table Download

CCNG1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CCNG1

Rabbit Polyclonal Anti-Cyclin G Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Cyclin G Antibody: A synthesized peptide derived from human Cyclin G

Rabbit polyclonal anti-Cyclin G antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Cyclin G.

Cyclin G (CCNG1) (C-term) rabbit polyclonal antibody, Purified

Applications FC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 249-280 amino acids from the C-terminal region of human CCNG1

Cyclin G (CCNG1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 20-53 amino acids from the N-terminal region of human CCNG1

Cyclin G (CCNG1) (N-term) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 27-61 amino acids from the N-terminal region of human CCNG1

Rabbit Polyclonal Anti-CCNG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCNG1 antibody: synthetic peptide directed towards the N terminal of human CCNG1. Synthetic peptide located within the following region: IEVLTTTDSQKLLHQLNALLEQESRCQPKVCGLRLIESAHDNGLRMTARL

Rabbit anti Cyclin G1 Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to C-terminal of human cyclin G1. This sequence is identical to human, mouse and rat.

CCNG1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CCNG1

Cyclin G1 Rabbit polyclonal Antibody

Applications ELISA, ICC/IF, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Modifications Unmodified

Cyclin G1 Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified