Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-Cyclin G Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cyclin G Antibody: A synthesized peptide derived from human Cyclin G |
Cyclin G (CCNG1) (N-term) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 27-61 amino acids from the N-terminal region of human CCNG1 |
Rabbit Polyclonal Anti-CCNG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCNG1 antibody: synthetic peptide directed towards the N terminal of human CCNG1. Synthetic peptide located within the following region: IEVLTTTDSQKLLHQLNALLEQESRCQPKVCGLRLIESAHDNGLRMTARL |
Rabbit anti Cyclin G1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to C-terminal of human cyclin G1. This sequence is identical to human, mouse and rat. |
Cyclin G1 Rabbit polyclonal Antibody
| Applications | ELISA, ICC/IF, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Modifications | Unmodified |
Cyclin G1 Rabbit polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Modifications | Unmodified |
Active filters
Target Symbol
- CCNG1