Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-CCR2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding to amino acid 353 of rat CCR2 |
Antibodies
View as table Download
Rabbit Polyclonal CCR2 Antibody
| Applications | FC, IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an N-terminal portion of the human CCR2 protein (within residues 20-100). [Swiss-Prot# P00338] |
Rabbit Polyclonal Anti-CCR2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCR2 antibody: synthetic peptide directed towards the middle region of human CCR2. Synthetic peptide located within the following region: LIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILL |
Rabbit Polyclonal Anti-CCR2 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Tested: Human |
| Immunogen | CCR2 antibody was raised against synthetic 20 amino acid peptide from N-terminal extracellular domain of human CCR2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%). |
Rabbit Polyclonal Anti-CCR2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CCR2 antibody is: synthetic peptide directed towards the N-terminal region of Human CCR2. Synthetic peptide located within the following region: RSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIF |
Rabbit Polyclonal Anti-CCR2 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Tested: Human; Predicted: Monkey |
| Immunogen | CCR2 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human CCR2. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon (95%); Monkey (90%). |
Mouse anti CCR-2 Monoclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
CCR2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
CCR2 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human CCR2. |
| Modifications | Unmodified |
CCR2 Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Modifications | Unmodified |
Active filters
Target Symbol
- CCR2