Antibodies

View as table Download

CCR8 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 297-325 amino acids from the C-terminal region of human CCR8

Rabbit Polyclonal CCR8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen CCR8 antibody was raised against a peptide corresponding to amino acids 183 to 201 of human CCR8, which locate in the second extracellular loop.

Rabbit Polyclonal Anti-CCR8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCR8 antibody: synthetic peptide directed towards the middle region of human CCR8. Synthetic peptide located within the following region: MATIPLLVFYQVASEDGVLQCYSFYNQQTLKWKIFTNFKMNILGLLIPFT

Rabbit Polyclonal Anti-CCR8 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen CCR8 antibody was raised against synthetic 18 amino acid peptide from N-terminal extracellular domain of human CCR8. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Marmoset, Elephant, Panda (83%).

Rabbit anti CCR8 Polyclonal Antibody

Applications WB
Reactivities Human
Immunogen A synthetic peptide of 170-203aa of human CCR 8. This sequence is identical to human, mouse and rat.

Rabbit anti CCR8 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated

Anti-CCR8 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 175-191 amino acids of Human chemokine (C-C motif) receptor 8

Anti-CCR8 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 175-191 amino acids of Human C-C chemokine receptor type 8

CCR8 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 296-355 of human CCR8 (NP_005192.1).
Modifications Unmodified

CCR8 Rabbit polyclonal Antibody

Applications FC, IF, WB
Reactivities Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human CCR8