Rabbit Polyclonal Anti-CD81 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
TAPA1 (CD81) mouse monoclonal antibody, clone M38, PE
| Applications | FC |
| Reactivities | Feline, Human, Rabbit |
| Conjugation | PE |
TAPA1 (CD81) mouse monoclonal antibody, clone M38, Purified
| Applications | FC, FN, IF, IHC, IP, WB |
| Reactivities | Feline, Human, Rabbit |
TAPA1 (CD81) mouse monoclonal antibody, clone M38, FITC
| Applications | FC |
| Reactivities | Feline, Human, Rabbit |
| Conjugation | FITC |
TAPA1 (CD81) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide |
Hamster Anti-Mouse CD81 Purified (50 ug)
| Applications | FC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
CD81 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CD81 |
CD81 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD81 (NP_004347.1). |
| Modifications | Unmodified |
Recombinant Anti-CD81 (Clone 1D6)
| Applications | ELISA, FC, IF, IHC, IP, WB |
| Reactivities | Chimpanzee, Goat, Human, Sheep |
| Conjugation | Unconjugated |
Recombinant Anti-CD81 (Clone 1D6)
| Applications | ELISA, FC, IF, IHC, IP, WB |
| Reactivities | Chimpanzee, Goat, Human, Sheep |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-CD81 (Clone 1.3.3.22)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Recombinant Anti-CD81 (Clone 1.3.3.22)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Germany
Japan
United Kingdom
China
