Rabbit Polyclonal Anti-CDCA5 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDCA5 antibody: synthetic peptide directed towards the middle region of human CDCA5. Synthetic peptide located within the following region: RRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVP |
Rabbit Polyclonal Anti-CDCA5 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDCA5 antibody: synthetic peptide directed towards the middle region of human CDCA5. Synthetic peptide located within the following region: ATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTST |
CDCA5 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CDCA5 |
CDCA5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 70-150 of human CDCA5 (NP_542399.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
