Rabbit polyclonal Anti-CDYL Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDYL antibody: synthetic peptide directed towards the n terminal of human CDYL. Synthetic peptide located within the following region: YIHDFNRRHTEKQKESTLTRTNRTSPNNARKQISRSTNSNFSKTSPKALV |
Goat Polyclonal Antibody against CDYL
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SMLKYLQRKIDEF, from the C Terminus of the protein sequence according to NP_004815.2; NP_736607.1; NP_736608.1. |
CDYL Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 245-544 of human CDYL (NP_004815.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
