Germany
Japan
United Kingdom
China
Antibodies
View as table Download
CELA1 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Porcine |
| Immunogen | Elastase isolated and purified from Porcine pancreas. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
CELA1 rabbit polyclonal antibody, Serum
| Applications | ELISA, WB |
| Reactivities | Porcine |
| Immunogen | Elastase from Porcine pancreas. |
CELA1 rabbit polyclonal antibody, Biotin, Purified
| Applications | ELISA, WB |
| Reactivities | Porcine |
| Conjugation | Biotin |
| Immunogen | Elastase from porcine pancreas |
CELA1 rabbit polyclonal antibody, HRP, Purified
| Applications | ELISA, WB |
| Reactivities | Porcine |
| Conjugation | HRP |
| Immunogen | Elastase from porcine pancreas |
CELA1 rabbit polyclonal antibody, Purified
| Applications | ELISA, WB |
| Reactivities | Porcine |
| Immunogen | Elastase from porcine pancreas |
Rabbit Polyclonal Anti-ELA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ELA1 antibody: synthetic peptide directed towards the N terminal of human ELA1. Synthetic peptide located within the following region: LVLYGHSTQDLPETNARVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGT |
Rabbit Polyclonal Anti-Ela1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ela1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RVVVGEHNLSQNDGTEQYVNVQKIVSHPYWNKNNVVAGYDIALLRLAKSV |
CELA1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CELA1 |
Active filters
Target Symbol
- CELA1