Rabbit Polyclonal Anti-Cela3b Antibody
| Applications | WB |
| Reactivities | Rat |
| Immunogen | The immunogen for anti-Cela3b antibody is: synthetic peptide directed towards the middle region of Rat Cela3b. Synthetic peptide located within the following region: PNGAPCYISGWGRLSTNGPLPDKLQQALLPVVDYAHCSKWDWWGFSVKKT |
CELA3B Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 80-190 of human CELA3B (NP_031378.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China