Antibodies

Jump to Filters
View as table Download
CUG BP1 (CELF1) Rabbit Polyclonal Antibody
TA345754

USD 475.00

5 Days

Rabbit Polyclonal Anti-CUGBP1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CUGBP1 antibody: synthetic peptide directed towards the N terminal of human CUGBP1. Synthetic peptide located within the following region: QMKPADSEKNNVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGP
CUG BP1 (CELF1) Rabbit Polyclonal Antibody
TA312319

USD 345.00

In Stock

Rabbit polyclonal anti-CELF-1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CELF-1.
CUG BP1 (CELF1) (+CUGBP2) Rabbit Polyclonal Antibody
AP20451PU-N

USD 370.00

2 Weeks

CUG BP1 (CELF1) (+CUGBP2) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 62-115 of Human CUG-BP1/2.
CUG BP1 (CELF1) Mouse Monoclonal Antibody [Clone ID: 3B1]
TA301501

USD 479.00

5 Days

Mouse Monoclonal Antibody against CUG-BP1 (3B1)

Applications WB
Reactivities Human, Mouse, Rat, Bovine, Porcine, Rabbit
Conjugation Unconjugated
CUG BP1 (CELF1) Mouse Monoclonal Antibody [Clone ID: OTI5B8]
CF500951

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) CUGBP1 mouse monoclonal antibody, clone OTI5B8 (formerly 5B8)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
CUG BP1 (CELF1) Rabbit Polyclonal Antibody
TA374626

USD 220.00

3 Weeks

CELF1 Rabbit polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 108-483 of human CELF1 (NP_941989.1).
Modifications Unmodified
CUG BP1 (CELF1) Mouse Monoclonal Antibody [Clone ID: OTI5B8]
TA500951

USD 379.00

In Stock

Anti-CUGBP1 mouse monoclonal antibody, clone OTI5B8 (formerly 5B8)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
CUG BP1 (CELF1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B8]
TA500951AM

USD 420.00

4 Weeks

Anti-CUGBP1 mouse monoclonal antibody, clone OTI5B8 (formerly 5B8), Biotinylated

Applications IF, IHC, WB
Reactivities Human
Conjugation Biotin
CUG BP1 (CELF1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5B8]
TA500951BM

USD 420.00

4 Weeks

Anti-CUGBP1 mouse monoclonal antibody, clone OTI5B8 (formerly 5B8), HRP conjugated

Applications IF, IHC, WB
Reactivities Human
Conjugation HRP
CUG BP1 (CELF1) Mouse Monoclonal Antibody [Clone ID: OTI5B8]
TA500951S

USD 159.00

In Stock

Anti-CUGBP1 mouse monoclonal antibody, clone OTI5B8 (formerly 5B8)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated