Antibodies

Jump to Filters
View as table Download
BRUNOL4 (CELF4) Rabbit Polyclonal Antibody
TA343893

USD 475.00

5 Days

Rabbit Polyclonal Anti-BRUNOL4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BRUNOL4 antibody: synthetic peptide directed towards the middle region of human BRUNOL4. Synthetic peptide located within the following region: PMAAFAAAQMQQMAALNMNGLAAAPMTPTSGGSTPPGITAPAVPSIPSPI
CELF4 Rabbit Polyclonal Antibody
TA367877

USD 380.00

4 Weeks

CELF4 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CELF4