Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-LASS4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LASS4 antibody: synthetic peptide directed towards the N terminal of human LASS4. Synthetic peptide located within the following region: MLSSFNEWFWQDRFWLPPNVTWTELEDRDGRVYPHPQDLLAALPLALVLL |
Rabbit Polyclonal Anti-LASS4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LASS4 Antibody: A synthesized peptide derived from human LASS4 |
Rabbit Polyclonal Anti-LASS4 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LASS4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LVAVRIVFERFVALPLSRWMGVQDPIRRKIKPNPVLEKYFLRMKQCPEET |
Rabbit Polyclonal Anti-LASS4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LASS4 antibody: synthetic peptide directed towards the C terminal of human LASS4. Synthetic peptide located within the following region: MLYSFMKKGQMEKDIRSDVEESDSSEEAAAAQEPLQLKNGAAGGPRPAPT |
Rabbit Polyclonal Anti-CERS4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CERS4 |
CERS4 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human CERS4 |
CERS4 Antibody - C-terminal
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human CERS4 |
CERS4 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human LASS4 |
Active filters
Target Symbol
- CERS4