Antibodies

View as table Download

Rabbit Polyclonal Anti-CFHR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CFHR2 antibody is: synthetic peptide directed towards the C-terminal region of Human CFHR2. Synthetic peptide located within the following region: KLKWTNQQKLYSRTGDIVEFVCKSGYHPTKSHSFRAMCQNGKLVYPSCEE

CFHR2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CFHR2

CFHR2 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CFHR2