Rabbit Polyclonal Anti-MB21D1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MB21D1 antibody: synthetic peptide directed towards the middle region of human MB21D1. Synthetic peptide located within the following region: VPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDC |
CGAS rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CGAS |
cGAS Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 400-522 of human cGAS (NP_612450.2). |
| Modifications | Unmodified |
cGAS Rabbit polyclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 350-522 of human cGAS (NP_612450.2). |
| Modifications | Unmodified |
Phospho-CGAS-S291 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphorylated peptide around S291 of human CGAS. |
| Modifications | Phospho S291 |
Phospho-CGAS-S291 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A phospho synthetic peptide corresponding to residues surrounding S291 of Mouse CGAS. |
Phospho-CGAS-S420 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho synthetic peptide corresponding to residues surrounding S420 of Mouse CGAS. |
| Modifications | Phospho S420 |
Germany
Japan
United Kingdom
China
