Rabbit Polyclonal Anti-CHCHD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHCHD1 antibody: synthetic peptide directed towards the N terminal of human CHCHD1. Synthetic peptide located within the following region: MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMS |
Rabbit Polyclonal Anti-CHCHD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHCHD1 antibody: synthetic peptide directed towards the middle region of human CHCHD1. Synthetic peptide located within the following region: KEIQGFLDCAARAQEARKMRSIQETLGESGSLLPNKLNKLLQRFPNKPYL |
CHCHD1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human CHCHD1 (NP_976043.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China