Rabbit Polyclonal Anti-CHMP4B Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHMP4B antibody: synthetic peptide directed towards the middle region of human CHMP4B. Synthetic peptide located within the following region: RKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAH |
Rabbit Polyclonal Anti-CHMP4B Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHMP4B antibody: synthetic peptide directed towards the middle region of human CHMP4B. Synthetic peptide located within the following region: EEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNLLEISGPETVPLP |
CHMP4B Antibody - C-terminal region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of mouse CHMP4B |
CHMP4B Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-224 of human CHMP4B (NP_789782.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
