Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CHN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHN2 antibody: synthetic peptide directed towards the N terminal of human CHN2. Synthetic peptide located within the following region: AFGVKVGVKGGFLWPPLKLFACSQISSLVRRAALTHNDNHFNYEKTHNFK |
Rabbit Polyclonal Anti-CHN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHN2 antibody: synthetic peptide directed towards the N terminal of human CHN2. Synthetic peptide located within the following region: NHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQC |
CHN2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human CHN2 (NP_004058.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CHN2