Antibodies

Jump to Filters
View as table Download
Chrna7 Rabbit Polyclonal Antibody
TA328885

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-Nicotinic Acetylcholine Receptor alpha7 (extracellular)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)KELVKNYNPLER, corresponding to amino acid residues 31-42 of rat nAChRa7. Extracellular, N-terminus.
Nicotinic Acetylcholine Receptor alpha 7 (CHRNA7) (Internal) Goat Polyclonal Antibody
AP22903PU-N

USD 440.00

2 Weeks

Nicotinic Acetylcholine Receptor alpha 7 (CHRNA7) (Internal) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Bovine, Canine, Chicken, Equine, Human, Monkey, Porcine
Immunogen Synthetic peptide from an internal region of human CHRNA7 (NP_000737.1)
Nicotinic Acetylcholine Receptor alpha 7 (CHRNA7) Rabbit Polyclonal Antibody
TA338736

USD 310.00

2 Weeks

Rabbit Polyclonal Anti-CHRNA7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNA7 antibody: synthetic peptide directed towards the middle region of human CHRNA7. Synthetic peptide located within the following region: VPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRF
Nicotinic Acetylcholine Receptor alpha 7 (CHRNA7) Goat Polyclonal Antibody
TA348983

USD 429.00

2 Weeks

Goat Polyclonal Anti-CHRNA7 Antibody

Reactivities Rat (Expected from sequence similarity: Human, Mouse, Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-CHRNA7 Antibody: Peptide with sequence KRPGEDKVRPACQHKQ, from the internal region of the protein sequence according to NP_000737.1.
Nicotinic Acetylcholine Receptor alpha 7 (CHRNA7) Rabbit Polyclonal Antibody
TA330424

USD 310.00

5 Days

Rabbit Polyclonal Anti-CHRNA7 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNA7 antibody: synthetic peptide directed towards the N terminal of human CHRNA7. Synthetic peptide located within the following region: QGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQV
Nicotinic Acetylcholine Receptor alpha 7 (CHRNA7) Rabbit Polyclonal Antibody
TA355841

USD 360.00

5 Days

CHRNA7 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of human CHRNA7
Nicotinic Acetylcholine Receptor alpha 7 (CHRNA7) Rabbit Polyclonal Antibody
TA374776

USD 220.00

3 Weeks

CHRNA7 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 23-230 of human CHRNA7 (NP_001177384.1).
Modifications Unmodified