Antibodies

View as table Download

Rabbit Polyclonal Anti-CHRNE Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNE antibody: synthetic peptide directed towards the N terminal of human CHRNE. Synthetic peptide located within the following region: GLLGRGVGKNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNLIS

CHRNE Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 21-239 of human CHRNE (NP_000071.1).
Modifications Unmodified