Antibodies

Jump to Filters
View as table Download
CILP2 Rabbit Polyclonal Antibody
TA331385

USD 375.00

5 Days

Rabbit Polyclonal Anti-CILP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CILP2 antibody is: synthetic peptide directed towards the N-terminal region of Human CILP2. Synthetic peptide located within the following region: RVHLNPTRGFWCLNREQPRGRRCSNYHVRFRCPLEASWGAWGPWGPCSGS