Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CLDN11 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLDN11 antibody: synthetic peptide directed towards the C terminal of human CLDN11. Synthetic peptide located within the following region: VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH |
Rabbit Polyclonal Anti-Claudin 11 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Claudin 11 Antibody: A synthesized peptide derived from human Claudin 11 |
Rabbit Polyclonal Anti-Claudin 11 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Cow |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Claudin 11 Antibody: A synthesized peptide derived from human Claudin 11 |
Rabbit polyclonal Claudin 11 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Claudin 11. |
USD 440.00
2 Weeks
Oligodendrocyte Specific Protein (CLDN11) (C-term) rabbit polyclonal antibody, Purified
| Applications | IHC |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide from C-terminal of human claudin 11 protein |
Rabbit anti Claudin 11 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
CLDN11 Antibody - middle region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse CLDN11 |
CLDN11 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CLDN11 (NP_005593.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CLDN11