Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Chemokine-like Receptor 1, (CMKLR1, G-Protein Coupled Receptor DEZ, ChemR23, belongs to the G-Protein Coupled Receptor (GPCR) family 1), rat anti mouse, clone 1G10
| Applications | IHC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Rabbit polyclonal anti-CMKLR1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CMKLR1. |
Rat Anti-Human CMKLR1 Purified (25 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CMKLR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CMKLR1 antibody: synthetic peptide directed towards the C terminal of human CMKLR1. Synthetic peptide located within the following region: KKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMNERTSMNERETGML |
Rabbit Polyclonal Anti-CMKLR1 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CHEMR23 / CMKLR1 antibody was raised against synthetic 19 amino acid peptide from C-terminal cytoplasmic domain of human CMKLR1. Percent identity with other species by BLAST analysis: Human, Gibbon (100%); Marmoset, Rabbit (95%); Horse (84%). |
Rabbit Polyclonal Anti-CMKLR1 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CMKLR1 |
CMKLR1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CMKLR1 |
CMKLR1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CMKLR1 (NP_001135815.1). |
| Modifications | Unmodified |
CMKLR1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CMKLR1 (NP_001135815.1). |
| Modifications | Unmodified |
Recombinant Anti-CMKLR1 (Clone BZ194)
| Applications | ELISA, FC, IF, IHC, IP, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-CMKLR1 (Clone BZ194)
| Applications | ELISA, FC, IF, IHC, IP, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- CMKLR1