Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CNN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNN2 antibody: synthetic peptide directed towards the N terminal of human CNN2. Synthetic peptide located within the following region: MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDF |
Goat Anti-Calponin 2 / CNN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DPGEVPEYPPYYQEE, from the internal region (near C Terminus) of the protein sequence according to NP_004359.1; NP_958434.1. |
Rabbit Polyclonal Anti-CNN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNN2 antibody: synthetic peptide directed towards the N terminal of human CNN2. Synthetic peptide located within the following region: YGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILC |
CNN2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CNN2 |
Active filters
Target Symbol
- CNN2