Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Mouse monoclonal Contactin/F3 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Contactin 1 (CNTN1) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 641~671 amino acids from the Central region of human CNTN1 |
Rabbit Polyclonal Anti-CNTN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNTN1 antibody: synthetic peptide directed towards the middle region of human CNTN1. Synthetic peptide located within the following region: QLEDEGIYECEAENIRGKDKHQARIYVQAFPEWVEHINDTEVDIGSDLYW |
Rabbit Polyclonal Anti-CNTN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNTN1 antibody: synthetic peptide directed towards the N terminal of human CNTN1. Synthetic peptide located within the following region: NGDVDLTSDRYSMVGGNLVINNPDKQKDAGIYYCLASNNYGMVRSTEATL |
CNTN1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CNTN1 (NP_778203.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CNTN1