Antibodies

Jump to Filters
View as table Download
CHCHD8 (COA4) Rabbit Polyclonal Antibody
TA345008

USD 475.00

5 Days

Rabbit Polyclonal Anti-CHCHD8 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHCHD8 antibody: synthetic peptide directed towards the middle region of human CHCHD8. Synthetic peptide located within the following region: SHFAVQECMAQHQDWRQCQPQVQAFKDCMSEQQARRQEELQRRQEQAGAH