Rabbit Polyclonal Anti-COG4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-COG4 Antibody: synthetic peptide directed towards the middle region of human COG4. Synthetic peptide located within the following region: LFSQGIGGEQAQAKFDSCLSDLAAVSNKFRDLLQEGLTELNSTAIKPQVQ |
Rabbit Polyclonal Anti-COG4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-COG4 Antibody: synthetic peptide directed towards the middle region of human COG4. Synthetic peptide located within the following region: TSLVAVELEKVVLKSTFNRLGGLQFDKELRSLIAYLTTVTTWTIRDKFAR |
COG4 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human COG4 |
COG4 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human COG4 |
COG4 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 310-410 of human COG4 (NP_056201.2). |
| Modifications | Unmodified |
COG4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 510-789 of human COG4 (NP_056201.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
