Antibodies

View as table Download

Coilin (COIL) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 156-186 amino acids from the Central region of human COIL

Rabbit Polyclonal Anti-Coil Antibody

Applications WB
Reactivities Rat
Immunogen The immunogen for Anti-Coil Antibody is: synthetic peptide directed towards the C-terminal region of Rat Coil. Synthetic peptide located within the following region: PETQQVDIEVLSSLPALKEPGKFDLVYHNENGTEVVEYAVTQEKRITVFW

Rabbit Polyclonal Anti-COIL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-COIL Antibody: synthetic peptide directed towards the C terminal of human COIL. Synthetic peptide located within the following region: DYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQ

COIL rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human COIL

COIL rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human COIL

Coilin Rabbit polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 297-576 of human Coilin (NP_004636.1).
Modifications Unmodified

Coilin Rabbit polyclonal Antibody

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Coilin

Coilin Rabbit monoclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated