Rabbit Polyclonal Anti-COL4A3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COL4A3 antibody: synthetic peptide directed towards the middle region of human COL4A3. Synthetic peptide located within the following region: DPGQPGPPGEQGPPGRCIEGPRGAQGLPGLNGLKGQQGRRGKTGPKGDPG |
Rabbit polyclonal Collagen IV a3 (Cleaved-Pro1426) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Collagen IV a3. |
Goat Anti-COL4A3 (aa341-353) Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RGPTEYYDTYQEK, from the internal region of the protein sequence according to NP_000082.2 |
Rabbit Polyclonal Anti-COL4A3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COL4A3 antibody: synthetic peptide directed towards the N terminal of human COL4A3. Synthetic peptide located within the following region: GPPGVPGSPGSSRPGLRGAPGWPGLKGSKGERGRPGKDAMGTPGSPGCAG |
Rabbit polyclonal Collagen IV a3 (Cleaved-Leu1425) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Collagen IV a3. |
Anti-COL4A3 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 41-52 amino acids of human collagen, type IV, alpha 3 (Goodpasture antigen) |
COL4A3 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1600 to the C-terminus of human COL4A3 (NP_000082.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
