Germany
Japan
United Kingdom
China
Goat Anti-COPA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CTRASNLENST, from the internal region of the protein sequence according to NP_001091868.1; NP_004362.2. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-COPA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COPA antibody: synthetic peptide directed towards the N terminal of human COPA. Synthetic peptide located within the following region: PWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFHKQQPLFVSGGD |
Rabbit Polyclonal Anti-COPA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COPA antibody: synthetic peptide directed towards the middle region of human COPA. Synthetic peptide located within the following region: IPKDADSQNPDAPEGKRSSGLTAVWVARNRFAVLDRMHSLLIKNLKNEIT |
COPA Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 550-650 of human COPA (NP_001091868.1). |
Active filters
Target Symbol
- COPA