COTL1 mouse monoclonal antibody, clone AT1D6, Purified
Applications | ELISA, WB |
Reactivities | Human |
COTL1 mouse monoclonal antibody, clone AT1D6, Purified
Applications | ELISA, WB |
Reactivities | Human |
COTL1 mouse monoclonal antibody, clone AT1D6, Purified
Applications | ELISA, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-COTL1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-COTL1 Antibody: synthetic peptide directed towards the N terminal of human COTL1. Synthetic peptide located within the following region: MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQ |
COTL1 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human COTL1 (NP_066972.1). |
Modifications | Unmodified |