Antibodies

View as table Download

Rabbit polyclonal anti-CPN2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human CPN2.

Rabbit Polyclonal Anti-CPN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CPN2 antibody: synthetic peptide directed towards the N terminal of human CPN2. Synthetic peptide located within the following region: FTTLETRAFGSNPNLTKVVFLNTQLCQFRPDAFGGLPRLEDLEVTGSSFL