Germany
Japan
United Kingdom
China
CPNE7 mouse monoclonal antibody, clone CPNE7-01, Aff - Purified
| Applications | WB |
| Reactivities | Human |
Antibodies
View as table Download
Rabbit Polyclonal Anti-Cpne7 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cpne7 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GARIPPKYEVSHDFAINFNPEDDECEGIQGVVEAYQNCLPKVQLYGPTNV |
Rabbit Polyclonal Anti-Cpne7 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cpne7 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: GDDGILRSPRGEPALRDIVQFVPFRELKNASPAALAKCVLAEVPKQVVEY |
CPNE7 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CPNE7 |
Active filters
Target Symbol
- CPNE7