Antibodies

View as table Download

Rabbit Polyclonal Anti-CPXCR1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CPXCR1 antibody: synthetic peptide directed towards the middle region of human CPXCR1. Synthetic peptide located within the following region: WANQLAAVAAGARVAGTQACATETIDTSRVSLRAPQEFMTSHSEAGSRIV

Rabbit Polyclonal Anti-CPXCR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CPXCR1 antibody: synthetic peptide directed towards the N terminal of human CPXCR1. Synthetic peptide located within the following region: SDTAGNAHKNSENEPPNDCSTDIESPSADPNMIYQVETNPINREPGTATS