Antibodies

View as table Download

Rabbit Polyclonal Anti-CRIP1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CRIP1 antibody: synthetic peptide directed towards the N terminal of human CRIP1. Synthetic peptide located within the following region: MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKP

Rabbit Polyclonal Anti-CRIP1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CRIP1 antibody: synthetic peptide directed towards the middle region of human CRIP1. Synthetic peptide located within the following region: PCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTF

CRIP1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-77 of human CRIP1 (NP_001302.1).
Modifications Unmodified