Germany
Japan
United Kingdom
China
Antibodies
View as table Download
CSF1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CSF1 |
Rabbit Polyclonal Anti-CSF1 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSF1 antibody: synthetic peptide directed towards the middle region of human CSF1. Synthetic peptide located within the following region: MAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPP |
Rabbit Polyclonal Anti-CSF1 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSF1 antibody: synthetic peptide directed towards the middle region of human CSF1. Synthetic peptide located within the following region: SGSVLPLGELEGRRSTRDRRSPAEPEGGPASEGAARPLPRFNSVPLTDTG |
M-CSF (CSF1) mouse monoclonal antibody, clone 116, Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
M-CSF (CSF1) mouse monoclonal antibody, clone 692, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
M-CSF (CSF1) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human M-CSF |
Biotinylated Anti-Murine M-CSF Goat Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Murine |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Murine M-CSF |
Rabbit Polyclonal Anti-CSF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSF1 antibody: synthetic peptide directed towards the N terminal of human CSF1. Synthetic peptide located within the following region: PPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQME |
Carrier-free (BSA/glycerol-free) CSF1 mouse monoclonal antibody, clone OTI1F8 (formerly 1F8)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
CSF1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 33-190 of human CSF1 (NP_757351.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
CSF1 mouse monoclonal antibody, clone OTI1F8 (formerly 1F8)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
CSF1 mouse monoclonal antibody, clone OTI1F8 (formerly 1F8), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
CSF1 mouse monoclonal antibody, clone OTI1F8 (formerly 1F8), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
CSF1 mouse monoclonal antibody, clone OTI1F8 (formerly 1F8)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- CSF1