Antibodies

Jump to Filters
View as table Download
CSNK1G3 Rabbit Polyclonal Antibody
TA340050

USD 375.00

5 Days

Rabbit Polyclonal Anti-CSNK1G3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSNK1G3 antibody: synthetic peptide directed towards the middle region of human CSNK1G3. Synthetic peptide located within the following region: LEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFP
CSNK1G3 Rabbit Polyclonal Antibody
TA375152

USD 220.00

3 Weeks

CSNK1G3 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 304-423 of human CSNK1G3 (NP_001026982.1).
Modifications Unmodified