Germany
Japan
United Kingdom
China
CKII alpha (CSNK2A1) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
Antibodies
View as table Download
Rabbit polyclonal CKII alpha (CSNK2A1) Antibody (Center)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CKII alpha (CSNK2A1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 240-269 amino acids from the Central region of human CKII alpha (CSNK2A1). |
CKII alpha (CSNK2A1) pThr360/pSer362 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Peptide sequence around phosphorylation site of Threonine 360/Serine 362 |
CKII alpha (CSNK2A1) pThr360/pSer362 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Peptide sequence around phosphorylation site of Threonine 360/Serine 362 |
CKII alpha (CSNK2A1) (353-357) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Peptide sequence around aa. 353~357 |
CKII alpha (CSNK2A1) (353-357) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Peptide sequence around aa. 353~357 |
Rabbit polyclonal anti-R Csnk2a1 antibody (N-term)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | This Rat Csnk2a1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 28-50 amino acids from the N-terminal region of Rat Csnk2a1. |
Phospho-CSNK2A1-T360/S362 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding T360/S362 of human CSNK2A1 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CSNK2A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSNK2A1 antibody: synthetic peptide directed towards the middle region of human CSNK2A1. Synthetic peptide located within the following region: LGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDP |
Anti-CSNK2A1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 39-324 amino acids of human casein kinase 2, alpha 1 polypeptide |
Casein Kinase 2 alpha (CSNK2A1) Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-391 of human Casein Kinase 2 alpha (CSNK2A1) (NP_001886.1). |
| Modifications | Unmodified |
Casein Kinase 2 alpha (CSNK2A1) Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-391 of human Casein Kinase 2 alpha (CSNK2A1) (NP_001886.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CSNK2A1