Germany
Japan
United Kingdom
China
FAM130A2 (CSRNP3) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 35-64 amino acids from the N-terminal region of human CSRNP3 |
Antibodies
View as table Download
Rabbit polyclonal anti-CSRNP3 (TAIP-2) antibody
| Applications | WB |
| Reactivities | Human Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TAIP-2. |
Rabbit Polyclonal Anti-CSRNP3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CSRNP3 Antibody is: synthetic peptide directed towards the N-terminal region of Human CSRNP3. Synthetic peptide located within the following region: KMTKNGTVESEEASTLTLDDISDDDIDLDNTEVDEYFFLQPLPTKKRRAL |
Active filters
Target Symbol
- CSRNP3