Antibodies

Jump to Filters
View as table Download
CST9 (C-term) Rabbit Polyclonal Antibody
AP51107PU-N

USD 450.00

2 Weeks

CST9 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 99-127 amino acids from the C-terminal region of human CST9.
CST9 Rabbit Polyclonal Antibody
TA336142

USD 375.00

5 Days

Rabbit Polyclonal Anti-CST9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CST9 Antibody: synthetic peptide directed towards the middle region of human CST9. Synthetic peptide located within the following region: IDNCPFQESLELNNVRQGISFPQVHSCGCCMGCGVGTGAADKAIPRDKGK
CST9 Rabbit Polyclonal Antibody
TA357554

USD 360.00

5 Days

CST9 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CST9