Antibodies

View as table Download

CST9 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 99-127 amino acids from the C-terminal region of human CST9.

Rabbit Polyclonal Anti-CST9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CST9 Antibody: synthetic peptide directed towards the middle region of human CST9. Synthetic peptide located within the following region: IDNCPFQESLELNNVRQGISFPQVHSCGCCMGCGVGTGAADKAIPRDKGK

CST9 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CST9