Antibodies

View as table Download

Rabbit Polyclonal Anti-CSTF3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSTF3 antibody: synthetic peptide directed towards the middle region of human CSTF3. Synthetic peptide located within the following region: FEELKKHEDSAIPRRLECLKEDVQRQQEREKELQHRYADLLLEKETLKSK

Rabbit Polyclonal Anti-CSTF3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSTF3 antibody: synthetic peptide directed towards the N terminal of human CSTF3. Synthetic peptide located within the following region: YIEAEIKAKNYDKVEKLFQRCLMKVLHIDLWKCYLSYVRETKGKLPSYKE

CSTF3 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CSTF3

CSTF3 Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified