Antibodies

View as table Download

Rabbit Polyclonal antibody to CTDSP2 (CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 2)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 26 and 271 of CTDSP2 (Uniprot ID#O14595)

CTDSP2 (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of human CTDSP2.

Rabbit Polyclonal Anti-CTDSP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTDSP2 antibody: synthetic peptide directed towards the N terminal of human CTDSP2. Synthetic peptide located within the following region: MEHGSIITQARREDALVLTKQGLVSKSSPKKPRGRNIFKALFCCFRAQHV

Rabbit Polyclonal Anti-CTDSP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTDSP2 antibody: synthetic peptide directed towards the middle region of human CTDSP2. Synthetic peptide located within the following region: ASYIFHPENAVPVQSWFDDMADTELLNLIPIFEELSGAEDVYTSLGQLRA

Carrier-free (BSA/glycerol-free) CTDSP2 mouse monoclonal antibody, clone OTI7F5 (formerly 7F5)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CTDSP2 mouse monoclonal antibody, clone OTI10G10 (formerly 10G10)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

CTDSP2 mouse monoclonal antibody, clone OTI7F5 (formerly 7F5)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

CTDSP2 mouse monoclonal antibody, clone OTI7F5 (formerly 7F5)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

CTDSP2 mouse monoclonal antibody, clone OTI10G10 (formerly 10G10)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

CTDSP2 mouse monoclonal antibody, clone OTI10G10 (formerly 10G10)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated