Germany
Japan
United Kingdom
China
Rabbit polyclonal antibody to Cullin5 (cullin 5)
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 113 and 583 of Cullin 5 (Uniprot ID#Q93034) |
Antibodies
View as table DownloadRabbit anti-CUL5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CUL5 |
Rabbit polyclonal anti-Cul5 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 4-18 of Human Cul5 (N-terminus) coupled to KLH. |
Rabbit Polyclonal Anti-CUL5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CUL5 antibody: synthetic peptide directed towards the C terminal of human CUL5. Synthetic peptide located within the following region: VNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHH |
Cullin 5 Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- CUL5