Germany
Japan
United Kingdom
China
Goat Anti-CutA protein Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QVTESVSDSIT, from the C Terminus of the protein sequence according to NP_001014433.1; NP_057005.1; NP_001014840.1. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-CUTA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CUTA Antibody: synthetic peptide directed towards the middle region of human CUTA. Synthetic peptide located within the following region: AFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVL |
CUTA Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse CUTA |
CUTA rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CUTA |
CUTA Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 21-156 of human CUTA (NP_001014840.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CUTA