Antibodies

Jump to Filters
View as table Download
CWC25 Rabbit Polyclonal Antibody
TA333768

USD 375.00

5 Days

Rabbit Polyclonal Anti-CWC25 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CWC25 Antibody is: synthetic peptide directed towards the C-terminal region of Human CWC25. Synthetic peptide located within the following region: RRETGQTRSPSPKKEVYQRRHAPGYTRKLSAEELERKRQEMMENAKWREE
CWC25 Rabbit Polyclonal Antibody
TA362244

USD 360.00

5 Days

CWC25 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CWC25